PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004516630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Trihelix
Protein Properties Length: 655aa    MW: 73568.1 Da    PI: 7.6157
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004516630.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix90.51.8e-2861144186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     rW+++e+laL+++r+em+ ++r+++ k+plWeevs++m+e g++r++k+Ckek+en+ k++k++keg+++++  + +t+++fdql+
  XP_004516630.1  61 RWPRNETLALLKIRSEMDVAFRDASVKGPLWEEVSRRMAEFGYQRNSKKCKEKFENVYKYHKRTKEGRGGKS--DGKTYRFFDQLQ 144
                     8********************************************************************964..5557******98 PP

2trihelix1032.3e-32480565187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k ev aLi++r++++++++++  k+plWee+s  m++ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  XP_004516630.1 480 RWPKTEVEALIKMRTSLDTKYQENGPKGPLWEEISGLMKKLGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 565
                     8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.5858120IPR001005SANT/Myb domain
PfamPF138372.6E-1860146No hitNo description
PROSITE profilePS500906.81860118IPR017877Myb-like domain
CDDcd122031.29E-2360125No hitNo description
SMARTSM007170.002477539IPR001005SANT/Myb domain
CDDcd122031.23E-27479544No hitNo description
Gene3DG3DSA:1.10.10.606.2E-4479536IPR009057Homeodomain-like
PfamPF138378.0E-22479566No hitNo description
PROSITE profilePS500907.189479537IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MLGGLSSSGD AAISAAGAQH DGGDTAGGGG YGGGGSNSGD DERGGGNRSE EGVDRSFGGN  60
RWPRNETLAL LKIRSEMDVA FRDASVKGPL WEEVSRRMAE FGYQRNSKKC KEKFENVYKY  120
HKRTKEGRGG KSDGKTYRFF DQLQALENNP SIQIQPSPTP SKLPPPQLNN STSSLPSQSL  180
PISTTSTTTM PLLFPPPLLN TTPPSTIPST ITTTLPISSP QIQGIVNTPS INLTNPTYFP  240
TTTTTNPDLP QTITPPSLFP NISTDLFSNS SSSSTSSEET TTTAEGGNRR KRKRKWKDFF  300
ERLKKEVVEK QEELHKRFLE AIEKRDNERV KREITWRLQE MQRIKREREV LAQERSIAAA  360
KDSAVMAFLQ KFAEQQNQEQ QHQQQNLVPP LNNNTNIPQQ EPQATTPMSM SMPTPQQIQV  420
QIPTSSMKQT TPVIPQAPPL TTTLTLTYQQ QQPEPANNME MIIKNDNNGE SNLMQPSSSR  480
WPKTEVEALI KMRTSLDTKY QENGPKGPLW EEISGLMKKL GYNRNAKRCK EKWENINKYF  540
KKVKESNKKR PEDSKTCPYF HQLDALYREK NKGDSPGVVS RPEGSMMIPL MVRPEQQWPP  600
QQQHPPLVTG TDVVMEDAEN DRPHRNEEEY YDDDDEDDEG SDNYVVVANK PPPAQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1288293RRKRKR
2288294RRKRKRK
3289294RKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004516630.10.0PREDICTED: trihelix transcription factor GT-2-like
TrEMBLQ9AVE40.0Q9AVE4_PEA; DNA-binding protein DF1
STRINGGLYMA16G28250.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-55Trihelix family protein